PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa018233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 340aa    MW: 36232 Da    PI: 9.0904
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-17464PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.92.2e-3880139362
     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                e  l+cprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk++s
  Lsa018233  80 EPGLNCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRNS 139
                56789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3363132IPR003851Zinc finger, Dof-type
PfamPF027014.8E-3283137IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.59983137IPR003851Zinc finger, Dof-type
PROSITE patternPS01361085121IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MVFSSVPPYL DHHNWHLQLQ QSNHQQASGA GGENPNLPPP PPPSQPGGGG GGGGGANGEG  60
SIRPGSMVDR ARMAKLPMPE PGLNCPRCDS TNTKFCYFNN YSLTQPRHFC KTCRRYWTRG  120
GALRNVPVGG GCRRNKRNSK NRSSKSPSQT GLKSVSESPS RCSTETMAST QLPHPPSLQL  180
PFMSSLGQYG GGGGNISSNL GGFQSQNEMG NFQLGSGSST GNNFNNILSI GGVENWRLPF  240
MAGFEVPSNS NLFHYQSEGV AEAPSSSMGG RGGDIRIPNS EIDNNQVDPP VKMEDNRGLN  300
LSRQFLGVSE STNNQPWVGT AWAGFSGVNS TSTTPTTHFL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505871.14e-83PREDICTED: dof zinc finger protein DOF3.6-like
TrEMBLA0A103Y6V70.0A0A103Y6V7_CYNCS; Zinc finger, Dof-type
STRINGGLYMA12G06880.24e-81(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-41DNA binding with one finger 2.4